PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc00_g14790
Common NameGSCOC_T00010265001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family ZF-HD
Protein Properties Length: 181aa    MW: 20450.1 Da    PI: 8.4137
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc00_g14790genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.12.9e-301569358
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                 +++Y eClkNhAa+ Ggha+DGCgEfmp  geegt++alkC+AC+CHRnFHR+  e
  Cc00_g14790 15 ALEYMECLKNHAAAAGGHATDGCGEFMPG-GEEGTIEALKCSACNCHRNFHRKVIE 69
                 679*************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-161676IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.8E-281768IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.9611867IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.7E-291866IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.8E-28107175IPR009057Homeodomain-like
SuperFamilySSF466891.57E-18108174IPR009057Homeodomain-like
TIGRFAMsTIGR015657.5E-26113169IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MHSSPEDHRL PNKKALEYME CLKNHAAAAG GHATDGCGEF MPGGEEGTIE ALKCSACNCH  60
RNFHRKVIEG DCSSQSYHSF FLVNVQLLQT SEKDEQEEGV HPEAKIRPHD AGKRRSRTKF  120
SQEQKEKLWS FAEKVGWKIQ KADDSAVNGF CQEIGIRRRV LKVWMHNNKH NLAKKNSYPC  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-211141711875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069129.13e-69PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ9M9S03e-59ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A068VGT31e-134A0A068VGT3_COFCA; Uncharacterized protein
STRINGVIT_12s0035g01880.t015e-67(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-53homeobox protein 31